Recombinant Human ALDOB

Cat.No. : ALDOB-26495TH
Product Overview : Recombinant fragment of Human ALDOB with an N terminal proprietary tag; Predicted MWt 34.76 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related housekeeping genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.
Protein length : 83 amino acids
Molecular Weight : 34.760kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANA
Sequence Similarities : Belongs to the class I fructose-bisphosphate aldolase family.
Tag : Non
Gene Name ALDOB aldolase B, fructose-bisphosphate [ Homo sapiens ]
Official Symbol ALDOB
Synonyms ALDOB; aldolase B, fructose-bisphosphate; fructose-bisphosphate aldolase B;
Gene ID 229
mRNA Refseq NM_000035
Protein Refseq NP_000026
MIM 612724
Uniprot ID P05062
Chromosome Location 9q21.3-q22.2
Pathway FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Fructose catabolism, organism-specific biosystem; Gluconeogenesis, organism-specific biosystem;
Function ATPase binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; fructose-bisphosphate aldolase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ALDOB Products

Required fields are marked with *

My Review for All ALDOB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon