Recombinant Human ALDH1A1 protein, His-tagged
Cat.No. : | ALDH1A1-3443H |
Product Overview : | Recombinant Human ALDH1A1 protein(153-501 aa), fused to His tag, was expressed in E. coli. |
Availability | February 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 153-501 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ALDH1A1 aldehyde dehydrogenase 1 family, member A1 [ Homo sapiens ] |
Official Symbol | ALDH1A1 |
Synonyms | ALDH1A1; aldehyde dehydrogenase 1 family, member A1; ALDH1, PUMB1; retinal dehydrogenase 1; RALDH1; retinaldehyde dehydrogenase 1; ALHDII; RALDH 1; ALDH class 1; acetaldehyde dehydrogenase 1; aldehyde dehydrogenase 1, soluble; aldehyde dehydrogenase, liver cytosolic; ALDC; ALDH1; PUMB1; ALDH11; ALDH-E1; MGC2318; |
Gene ID | 216 |
mRNA Refseq | NM_000689 |
Protein Refseq | NP_000680 |
MIM | 100640 |
UniProt ID | P00352 |
◆ Recombinant Proteins | ||
ALDH1A1-1518M | Recombinant Mouse ALDH1A1 Protein | +Inquiry |
ALDH1A1-5040H | Recombinant Human ALDH1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Aldh1a1-1356M | Recombinant Mouse Aldh1a1 protein, His & T7-tagged | +Inquiry |
ALDH1A1-01H | Active Recombinant Human ALDH1A1 Protein | +Inquiry |
ALDH1A1-27035TH | Recombinant Human ALDH1A1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1A1-8922HCL | Recombinant Human ALDH1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALDH1A1 Products
Required fields are marked with *
My Review for All ALDH1A1 Products
Required fields are marked with *
0
Inquiry Basket