Recombinant Human ALDH1A1, His-tagged

• Cat.No.: ALDH1A1-27036TH
• Product Overview: Recombinant fragment, corresponding to amino acids 255-501 of Human ALDH1A1 with an N terminal His tag. observed mol wt: 29 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 255-501 a.a.
• Description: The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 135 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHG VFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYIL GNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLEC GGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMK FKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQ AGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEY TEVKTVTVKISQKNS
• Sequence Similarities: Belongs to the aldehyde dehydrogenase family.

Gene Information

• Gene Name: ALDH1A1 aldehyde dehydrogenase 1 family, member A1 [ Homo sapiens ]
• Official Symbol: ALDH1A1
• Synonyms: ALDH1A1; aldehyde dehydrogenase 1 family, member A1; ALDH1, PUMB1; retinal dehydrogenase 1; RALDH1; retinaldehyde dehydrogenase 1
• Gene ID: 216
• mRNA Refseq: NM_000689
• Protein Refseq: NP_000680
• MIM: 100640
• Uniprot ID: P00352
• Chromosome Location: 9q21.13
• Pathway: Biological oxidations, organism-specific biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: Ras GTPase activator activity; aldehyde dehydrogenase (NAD) activity; androgen binding; oxidoreductase activity; retinal dehydrogenase activity