Recombinant Human AKAP9 Protein, GST-tagged
Cat.No. : | AKAP9-405H |
Product Overview : | Human AKAP9 partial ORF ( NP_671700, 3812 a.a. - 3911 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in at least two isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKAP9 A kinase (PRKA) anchor protein (yotiao) 9 [ Homo sapiens ] |
Official Symbol | AKAP9 |
Synonyms | AKAP9; A kinase (PRKA) anchor protein (yotiao) 9; A-kinase anchor protein 9; A kinase anchor protein; 350kDa; A kinase anchoring protein 450; AKAP9 BRAF fusion protein; AKAP120 like protein; AKAP350; AKAP450; centrosome and golgi localized protein; CG NAP; HYPERION; KIAA0803; kinase N associated protein; MU RMS 40.16A; PPP1R45; PRKA9; protein kinase A anchoring protein 9; protein phosphatase 1; regulatory subunit 45; YOTIAO; protein yotiao; protein hyperion; AKAP 120-like protein; AKAP9-BRAF fusion protein; kinase N-associated protein; A-kinase anchor protein 350 kDa; A-kinase anchor protein 450 kDa; protein phosphatase 1, regulatory subunit 45; centrosome- and Golgi-localized PKN-associated protein; AKAP-9; CG-NAP; MU-RMS-40.16A; |
Gene ID | 10142 |
mRNA Refseq | NM_005751 |
Protein Refseq | NP_005742 |
MIM | 604001 |
UniProt ID | Q99996 |
◆ Recombinant Proteins | ||
AKAP9-26527TH | Recombinant Human AKAP9, His-tagged | +Inquiry |
AKAP9-7119C | Recombinant Chicken AKAP9 | +Inquiry |
ACP6-3722H | Recombinant Human ACP6 protein, His-tagged | +Inquiry |
AKAP9-405H | Recombinant Human AKAP9 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKAP9 Products
Required fields are marked with *
My Review for All AKAP9 Products
Required fields are marked with *
0
Inquiry Basket