Recombinant Human AKAP9, His-tagged

Cat.No. : AKAP9-26527TH
Product Overview : Recombinant fragment, corresponding to amino acids 3496-3773 of Human AKAP9 with N terminal His tag; 278 amino acids, 32kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 3496-3773 a.a.
Description : The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in at least two isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3.
Conjugation : HIS
Tissue specificity : Widely expressed. Isoform 4 is highly expressed in skeletal muscle and in pancreas.
Form : Lyophilised:Reconstitute with 82 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GGTGCNHELEMIRQKLQCVASKLQVLPQKASERLQFETAD DEDFIWVQENIDEIILQLQKLTGQQGEEPSLVSPSTSC GSLTERLLRQNAELTGHISQLTEEKNDLRNMVMKLEEQIR WYRQTGAGRDNSSRFSLNGGANIEAIIASEKEVWNREK LTLQKSLKRAEAEVYKLKAELRNDSLLQTLSPDSEHVT LKRIYGKYLRAESFRKALIYQKKYLLLLLGGFQECEDATL ALLARMGGQPAFTDLEVITNRPKGFTRFRSAVRVSIAI SRMKFL
Gene Name AKAP9 A kinase (PRKA) anchor protein (yotiao) 9 [ Homo sapiens ]
Official Symbol AKAP9
Synonyms AKAP9; A kinase (PRKA) anchor protein (yotiao) 9; A-kinase anchor protein 9; A kinase anchor protein; 350kDa; A kinase anchoring protein 450; AKAP9 BRAF fusion protein; AKAP120 like protein; AKAP350; AKAP450; centrosome and golgi localized protein; CG NA
Gene ID 10142
mRNA Refseq NM_005751
Protein Refseq NP_005742
MIM 604001
Uniprot ID Q99996
Chromosome Location 7q21-q22
Pathway Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem;
Function kinase activity; protein binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AKAP9 Products

Required fields are marked with *

My Review for All AKAP9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon