Recombinant Human AHNAK Protein, GST-tagged

• Cat.No.: AHNAK-461H
• Product Overview: Human AHNAK partial ORF ( NP_076965, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a large (700 kDa) structural scaffold protein consisting of a central domain with 128 aa repeats. The encoded protein may play a role in such diverse processes as blood-brain barrier formation, cell structure and migration, cardiac calcium channel regulation, and tumor metastasis. A much shorter variant encoding a 17 kDa isoform exists for this gene, and the shorter isoform initiates a feedback loop that regulates alternative splicing of this gene. [provided by RefSeq, Oct 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AHNAK AHNAK nucleoprotein [ Homo sapiens ]
• Official Symbol: AHNAK
• Synonyms: AHNAK; AHNAK nucleoprotein; AHNAK nucleoprotein (desmoyokin); neuroblast differentiation-associated protein AHNAK; desmoyokin; MGC5395; AHNAK-related; AHNAKRS
• Gene ID: 79026
• mRNA Refseq: NM_001620
• Protein Refseq: NP_001611
• MIM: 103390
• UniProt ID: Q09666