Recombinant Full Length Human AHNAK Protein, C-Flag-tagged

• Cat.No.: AHNAK-1296HFL
• Product Overview: Recombinant Full Length Human AHNAK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: The protein encoded by this gene is a large (700 kDa) structural scaffold protein consisting of a central domain with 128 aa repeats. The encoded protein may play a role in such diverse processes as blood-brain barrier formation, cell structure and migration, cardiac calcium channel regulation, and tumor metastasis. A much shorter variant encoding a 17 kDa isoform exists for this gene, and the shorter isoform initiates a feedback loop that regulates alternative splicing of this gene.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 15.9 kDa
• AA Sequence: MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEV TQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVFLNTPQPSALECKDQNKQKEASSQAGAV
  SVSTPNAGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Protease
• Full Length: Full L.

Gene Information

• Gene Name: AHNAK AHNAK nucleoprotein [ Homo sapiens (human) ]
• Official Symbol: AHNAK
• Synonyms: PM227; AHNAK1; AHNAKRS
• Gene ID: 79026
• mRNA Refseq: NM_024060.4
• Protein Refseq: NP_076965.2
• MIM: 103390
• UniProt ID: Q9BVU3