Recombinant Human AES Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AES-1497H
• Product Overview: AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.8 kDa
• AA Sequence: MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AES amino-terminal enhancer of split [ Homo sapiens (human) ]
• Official Symbol: AES
• Synonyms: AES; amino-terminal enhancer of split; GRG5; TLE5; gp130-associated protein GAM; GRG; ESP1; AES-1; AES-2
• Gene ID: 166
• mRNA Refseq: NM_001130
• Protein Refseq: NP_001121
• MIM: 600188
• UniProt ID: Q08117