Recombinant Human AES Protein, GST-tagged

• Cat.No.: AES-398H
• Product Overview: Human AES partial ORF ( NP_001121, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.73 kDa
• AA Sequence: MFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIER
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AES amino-terminal enhancer of split [ Homo sapiens ]
• Official Symbol: AES
• Synonyms: AES; amino-terminal enhancer of split; GRG5; TLE5; gp130-associated protein GAM; GRG; ESP1; AES-1; AES-2
• Gene ID: 166
• mRNA Refseq: NM_001130
• Protein Refseq: NP_001121
• MIM: 600188
• UniProt ID: Q08117