Recombinant Human ADIPOR2, GST-tagged

Cat.No. : ADIPOR2-210H
Product Overview : Human ADIPOR2 full-length ORF ( NP_078827.2, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
Molecular Mass : 70.3 kDa
AA Sequence : MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGF MGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIW THLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIAL LIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFM IGGGCSEEDAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADIPOR2 adiponectin receptor 2 [ Homo sapiens (human) ]
Official Symbol ADIPOR2
Synonyms ADIPOR2; PAQR2; ACDCR2; adiponectin receptor 2; progestin and adipoQ receptor family member II
Gene ID 79602
mRNA Refseq NM_024551
Protein Refseq NP_078827
MIM 607946
UniProt ID Q86V24
Chromosome Location 12p13.31
Pathway AMPK signaling; Adipocytokine signaling pathway
Function hormone binding; identical protein binding; protein heterodimerization activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADIPOR2 Products

Required fields are marked with *

My Review for All ADIPOR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon