Recombinant Human ADIPOR2, GST-tagged
Cat.No. : | ADIPOR2-210H |
Product Overview : | Human ADIPOR2 full-length ORF ( NP_078827.2, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin. |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGF MGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIW THLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIAL LIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFM IGGGCSEEDAL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADIPOR2 adiponectin receptor 2 [ Homo sapiens (human) ] |
Official Symbol | ADIPOR2 |
Synonyms | ADIPOR2; PAQR2; ACDCR2; adiponectin receptor 2; progestin and adipoQ receptor family member II |
Gene ID | 79602 |
mRNA Refseq | NM_024551 |
Protein Refseq | NP_078827 |
MIM | 607946 |
UniProt ID | Q86V24 |
Chromosome Location | 12p13.31 |
Pathway | AMPK signaling; Adipocytokine signaling pathway |
Function | hormone binding; identical protein binding; protein heterodimerization activity |
◆ Recombinant Proteins | ||
AMZ2-9632H | Recombinant Human AMZ2, GST-tagged | +Inquiry |
CALY-1100H | Recombinant Human CALY protein, His & T7-tagged | +Inquiry |
RFL24142HF | Recombinant Full Length Human Putative High Affinity Immunoglobulin Gamma Fc Receptor Ic(Fcgr1C) Protein, His-Tagged | +Inquiry |
CAMK2D-27263TH | Recombinant Human CAMK2D | +Inquiry |
YCEI-1831B | Recombinant Bacillus subtilis YCEI protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
IgG-011H | Native Human Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
◆ Cell & Tissue Lysates | ||
REN-2862HCL | Recombinant Human REN cell lysate | +Inquiry |
MYCL1-4037HCL | Recombinant Human MYCL1 293 Cell Lysate | +Inquiry |
ING3-5207HCL | Recombinant Human ING3 293 Cell Lysate | +Inquiry |
ZNF189-1991HCL | Recombinant Human ZNF189 cell lysate | +Inquiry |
SLC25A36-1765HCL | Recombinant Human SLC25A36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADIPOR2 Products
Required fields are marked with *
My Review for All ADIPOR2 Products
Required fields are marked with *
0
Inquiry Basket