Recombinant Human ADIPOR1 Full Length Transmembrane protein, His-SUMO & Myc-tagged
Cat.No. : | ADIPOR1-249H |
Product Overview : | Recombinant Human ADIPOR1 protein(Q96A54)(1-375aa), fused with N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-375aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 62.6kDa |
AA Sequence : | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens ] |
Official Symbol | ADIPOR1 |
Synonyms | ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464; |
Gene ID | 51094 |
mRNA Refseq | NM_015999 |
Protein Refseq | NP_057083 |
MIM | 607945 |
UniProt ID | Q96A54 |
◆ Recombinant Proteins | ||
ADIPOR1-2350H | Recombinant Human ADIPOR1 protein, His-SUMO & Myc-tagged | +Inquiry |
ADIPOR1-22H | Recombinant Human ADIPOR1 protein, MYC/DDK-tagged | +Inquiry |
ADIPOR1-625H | Recombinant Human ADIPOR1, GST-tagged | +Inquiry |
ADIPOR1-1354H | Recombinant Human ADIPOR1 Transmembrane protein, His-Flag-tagged | +Inquiry |
ADIPOR1-2351H | Recombinant Human ADIPOR1 protein, His-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *
0
Inquiry Basket