Recombinant Human ADIPOR1 Full Length Transmembrane protein, His-SUMO & Myc-tagged

• Cat.No.: ADIPOR1-249H
• Product Overview: Recombinant Human ADIPOR1 protein(Q96A54)(1-375aa), fused with N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: His&Myc&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 62.6kDa
• Protein length: 1-375aa
• AA Sequence: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ADIPOR1 adiponectin receptor 1 [ Homo sapiens ]
• Official Symbol: ADIPOR1
• Synonyms: ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464
• Gene ID: 51094
• mRNA Refseq: NM_015999
• Protein Refseq: NP_057083
• MIM: 607945
• UniProt ID: Q96A54