Recombinant Human ADIPOR1 protein, His/SUMO-tagged

• Cat.No.: ADIPOR1-626H
• Product Overview: Recombinant Human DNASE1L3(1-375 aa) fused with His/SUMO tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-375 aa
• Description: This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.
• Form: Tris-based buffer, 50% glycerol
• AA Sequence: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE FRYGLEGGCTDDTLL
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.

Gene Information

• Gene Name: ADIPOR1 adiponectin receptor 1 [ Homo sapiens ]
• Official Symbol: ADIPOR1
• Synonyms: ADIPOR1; adiponectin receptor 1; adiponectin receptor protein 1; ACDCR1; PAQR1; progestin and adipoQ receptor family member I; CGI45; CGI-45; TESBP1A; FLJ25385; FLJ42464
• Gene ID: 51094
• mRNA Refseq: NM_015999
• Protein Refseq: NP_057083
• MIM: 607945
• UniProt ID: Q96A54
• Chromosome Location: 1q32.1
• Pathway: Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem
• Function: hormone binding; identical protein binding; protein heterodimerization activity; protein kinase binding; receptor activity