Recombinant Human ADCYAP1 Protein, GST-tagged

Cat.No. : ADCYAP1-334H
Product Overview : Human ADCYAP1 partial ORF ( NP_001108.1, 95 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
Molecular Mass : 34.32 kDa
AA Sequence : VLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCYAP1 adenylate cyclase activating polypeptide 1 (pituitary) [ Homo sapiens ]
Official Symbol ADCYAP1
Synonyms ADCYAP1; adenylate cyclase activating polypeptide 1 (pituitary); pituitary adenylate cyclase-activating polypeptide; PACAP; MGC126852;
Gene ID 116
mRNA Refseq NM_001099733
Protein Refseq NP_001093203
MIM 102980
UniProt ID P18509

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADCYAP1 Products

Required fields are marked with *

My Review for All ADCYAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon