Recombinant Human ADCYAP1 Protein, GST-tagged

• Cat.No.: ADCYAP1-334H
• Product Overview: Human ADCYAP1 partial ORF ( NP_001108.1, 95 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.32 kDa
• AA Sequence: VLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADCYAP1 adenylate cyclase activating polypeptide 1 (pituitary) [ Homo sapiens ]
• Official Symbol: ADCYAP1
• Synonyms: ADCYAP1; adenylate cyclase activating polypeptide 1 (pituitary); pituitary adenylate cyclase-activating polypeptide; PACAP; MGC126852
• Gene ID: 116
• mRNA Refseq: NM_001099733
• Protein Refseq: NP_001093203
• MIM: 102980
• UniProt ID: P18509