Recombinant Human ADCYAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ADCYAP1-4155H
Product Overview : ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001093203) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 18.8 kDa
AA Sequence : MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ADCYAP1 adenylate cyclase activating polypeptide 1 [ Homo sapiens (human) ]
Official Symbol ADCYAP1
Synonyms ADCYAP1; adenylate cyclase activating polypeptide 1 (pituitary); pituitary adenylate cyclase-activating polypeptide; PACAP; MGC126852;
Gene ID 116
mRNA Refseq NM_001099733
Protein Refseq NP_001093203
MIM 102980
UniProt ID P18509

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADCYAP1 Products

Required fields are marked with *

My Review for All ADCYAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon