Recombinant Human ADAM23 protein(621-710 aa), C-His-tagged

• Cat.No.: ADAM23-2479H
• Product Overview: Recombinant Human ADAM23 protein(O75077)(621-710 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 621-710 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: GSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVED
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ADAM23 ADAM metallopeptidase domain 23 [ Homo sapiens ]
• Official Symbol: ADAM23
• Synonyms: ADAM23; ADAM metallopeptidase domain 23; a disintegrin and metalloproteinase domain 23; disintegrin and metalloproteinase domain-containing protein 23; MDC3; MDC-3; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
• Gene ID: 8745
• mRNA Refseq: NM_003812
• Protein Refseq: NP_003803
• MIM: 603710
• UniProt ID: O75077