Recombinant Full Length Human Disintegrin And Metalloproteinase Domain-Containing Protein 23(Adam23) Protein, His-Tagged
Cat.No. : | RFL-10351HF |
Product Overview : | Recombinant Full Length Human Disintegrin and metalloproteinase domain-containing protein 23(ADAM23) Protein (O75077) (287-832aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (287-832) |
Form : | Lyophilized powder |
AA Sequence : | AVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADAM23 |
Synonyms | ADAM23; MDC3; Disintegrin and metalloproteinase domain-containing protein 23; ADAM 23; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3; MDC-3 |
UniProt ID | O75077 |
◆ Recombinant Proteins | ||
ADAM23-1025H | Active Recombinant Human ADAM23 Protein, His-tagged | +Inquiry |
ADAM23-2479H | Recombinant Human ADAM23 protein(621-710 aa), C-His-tagged | +Inquiry |
ADAM23-3916C | Recombinant Chicken ADAM23 | +Inquiry |
RFL-10351HF | Recombinant Full Length Human Disintegrin And Metalloproteinase Domain-Containing Protein 23(Adam23) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM23 Products
Required fields are marked with *
My Review for All ADAM23 Products
Required fields are marked with *
0
Inquiry Basket