Recombinant Human ACTN1 Protein, GST-tagged

Cat.No. : ACTN1-229H
Product Overview : Human ACTN1 partial ORF ( NP_001093, 543 a.a. - 639 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.41 kDa
AA Sequence : EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACTN1 actinin, alpha 1 [ Homo sapiens ]
Official Symbol ACTN1
Synonyms ACTN1; actinin, alpha 1; alpha-actinin-1; actinin 1 smooth muscle; non-muscle alpha-actinin-1; F-actin cross-linking protein; alpha-actinin cytoskeletal isoform; FLJ40884; FLJ54432;
Gene ID 87
mRNA Refseq NM_001102
Protein Refseq NP_001093
MIM 102575
UniProt ID P12814

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACTN1 Products

Required fields are marked with *

My Review for All ACTN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon