Recombinant Human ACAD8 Protein, GST-Tagged
Cat.No. : | ACAD8-129H |
Product Overview : | Human ACAD8 full-length ORF ( AAH01964, 1 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.[provided by RefSeq, Nov 2009] |
Molecular Mass : | 71.39 kDa |
AA Sequence : | MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACAD8 acyl-CoA dehydrogenase family, member 8 [ Homo sapiens ] |
Official Symbol | ACAD8 |
Synonyms | ACAD8; acyl-CoA dehydrogenase family, member 8; acyl Coenzyme A dehydrogenase family, member 8; isobutyryl-CoA dehydrogenase, mitochondrial; activator-recruited cofactor 42 kDa component; acyl-Coenzyme A dehydrogenase family, member 8; ARC42; ACAD-8; |
Gene ID | 27034 |
mRNA Refseq | NM_014384 |
Protein Refseq | NP_055199 |
MIM | 604773 |
UniProt ID | Q9UKU7 |
◆ Recombinant Proteins | ||
ACAD8-129H | Recombinant Human ACAD8 Protein, GST-Tagged | +Inquiry |
ACAD8-5336C | Recombinant Chicken ACAD8 | +Inquiry |
Acad8-1485M | Recombinant Mouse Acad8 Protein, Myc/DDK-tagged | +Inquiry |
ACAD8-893HF | Recombinant Full Length Human ACAD8 Protein, GST-tagged | +Inquiry |
ACAD8-338H | Recombinant Human acyl-CoA dehydrogenase family, member 8, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD8-9116HCL | Recombinant Human ACAD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACAD8 Products
Required fields are marked with *
My Review for All ACAD8 Products
Required fields are marked with *
0
Inquiry Basket