Recombinant Human ACAD8 Protein, GST-Tagged

• Cat.No.: ACAD8-129H
• Product Overview: Human ACAD8 full-length ORF ( AAH01964, 1 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.[provided by RefSeq, Nov 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 71.39 kDa
• AA Sequence: MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACAD8 acyl-CoA dehydrogenase family, member 8 [ Homo sapiens ]
• Official Symbol: ACAD8
• Synonyms: ACAD8; acyl-CoA dehydrogenase family, member 8; acyl Coenzyme A dehydrogenase family, member 8; isobutyryl-CoA dehydrogenase, mitochondrial; activator-recruited cofactor 42 kDa component; acyl-Coenzyme A dehydrogenase family, member 8; ARC42; ACAD-8
• Gene ID: 27034
• mRNA Refseq: NM_014384
• Protein Refseq: NP_055199
• MIM: 604773
• UniProt ID: Q9UKU7