Recombinant Human ACAA1, His-tagged

Description :	This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
Protein length :	398 amino acids
Conjugation :	HIS
Molecular Weight :	43.800kDa
Source :	E. coli
Form :	Liquid
Purity :	>95% by SDS-PAGE
Storage buffer :	Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage :	Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids :	MGSSHHHHHHSSGLVPRGSHMLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Sequence Similarities :	Belongs to the thiolase family.

Gene Name	ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ]
Official Symbol	ACAA1
Synonyms	ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase;
Gene ID	30
mRNA Refseq	NM_001130410
Protein Refseq	NP_001123882
MIM	604054
Uniprot ID	P09110
Chromosome Location	3p23-p22
Pathway	Beta-oxidation of very long chain fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem;
Function	acetyl-CoA C-acyltransferase activity; protein binding; transferase activity, transferring acyl groups other than amino-acyl groups;