Recombinant Human ACAA1, His-tagged

• Cat.No.: ACAA1-26046TH
• Product Overview: Recombinant full length Human ACAA1 with an N terminal His tag; 419 amino acids including tag, MWt 43.8kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 398 amino acids
• Description: This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
• Conjugation: HIS
• Molecular Weight: 43.800kDa
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
• Sequence Similarities: Belongs to the thiolase family.

Gene Information

• Gene Name: ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ]
• Official Symbol: ACAA1
• Synonyms: ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase
• Gene ID: 30
• mRNA Refseq: NM_001130410
• Protein Refseq: NP_001123882
• MIM: 604054
• Uniprot ID: P09110
• Chromosome Location: 3p23-p22
• Pathway: Beta-oxidation of very long chain fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem
• Function: acetyl-CoA C-acyltransferase activity; protein binding; transferase activity, transferring acyl groups other than amino-acyl groups