Recombinant Human ABL2 Protein, GST-Tagged

• Cat.No.: ABL2-106H
• Product Overview: Human ABL2 partial ORF ( AAH65912, 743 a.a. - 842 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009]
• Molecular Mass: 36.41 kDa
• AA Sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABL2 v-abl Abelson murine leukemia viral oncogene homolog 2 [ Homo sapiens ]
• Official Symbol: ABL2
• Synonyms: ABL2; v-abl Abelson murine leukemia viral oncogene homolog 2; ABLL, v abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson related gene); Abelson tyrosine-protein kinase 2; Abelson related gene; ARG; tyrosine-protein kinase ARG; abelson-related gene protein; ABLL
• Gene ID: 27
• mRNA Refseq: NM_001136000
• Protein Refseq: NP_001129472
• MIM: 164690
• UniProt ID: P42684