Recombinant Human ABI1 Protein, GST-Tagged

• Cat.No.: ABI1-086H
• Product Overview: Human ABI1 partial ORF ( NP_001012770, 185 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Sep 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.68 kDa
• AA Sequence: GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABI1 abl-interactor 1 [ Homo sapiens ]
• Official Symbol: ABI1
• Synonyms: ABI1; abl-interactor 1; spectrin SH3 domain binding protein 1 , SSH3BP1; abl interactor 1; ABI 1; E3B1; Abelson interactor 1; nap1 binding protein; abl-binding protein 4; interactor protein AblBP4; Abl-interactor protein 1 long; eps8 SH3 domain-binding protein; spectrin SH3 domain-binding protein 1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1
• Gene ID: 10006
• mRNA Refseq: NM_001012750
• Protein Refseq: NP_001012768
• MIM: 603050
• UniProt ID: Q8IZP0