Recombinant Human ABHD6 Protein, GST-Tagged

• Cat.No.: ABHD6-082H
• Product Overview: Human ABHD6 full-length ORF ( AAH01698.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ABHD6 (Abhydrolase Domain Containing 6) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and triacylglycerol degradation. GO annotations related to this gene include acylglycerol lipase activity.
• Molecular Mass: 64.7 kDa
• AA Sequence: MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABHD6 abhydrolase domain containing 6 [ Homo sapiens ]
• Official Symbol: ABHD6
• Synonyms: Abhydrolase Domain Containing 6; EC 3.1.1.23; Abhydrolase Domain-Containing Protein 6; 2-Arachidonoylglycerol Hydrolase
• Gene ID: 57406
• mRNA Refseq: NM_020676
• Protein Refseq: NP_065727
• MIM: 616966
• UniProt ID: Q9BV23