Recombinant Human ABHD6 Protein, C-Myc/DDK-tagged

• Cat.No.: ABHD6-11H
• Product Overview: Recombinant protein of human abhydrolase domain containing 6 (ABHD6) with a C-Myc/DDK tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Enables acylglycerol lipase activity. Involved in acylglycerol catabolic process. Predicted to be located in late endosome membrane and lysosomal membrane. Predicted to be integral component of membrane. Predicted to be part of AMPA glutamate receptor complex. Predicted to be active in GABA-ergic synapse; glutamatergic synapse; and mitochondrion. Predicted to be integral component of postsynaptic membrane.
• Molecular Mass: 38.2 kDa
• AA Sequence: MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 μg/mL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Gene Information

• Gene Name: ABHD6 abhydrolase domain containing 6, acylglycerol lipase [ Homo sapiens (human) ]
• Official Symbol: ABHD6
• Synonyms: ABHD6; abhydrolase domain containing 6, acylglycerol lipase; monoacylglycerol lipase ABHD6; 2-arachidonoylglycerol hydrolase; abhydrolase domain-containing protein 6; lipase protein; EC 3.1.1.23
• Gene ID: 57406
• mRNA Refseq: NM_020676
• Protein Refseq: NP_065727
• MIM: 616966
• UniProt ID: Q9BV23