Recombinant Human AMTN protein, His-tagged
Cat.No. : | AMTN-390H |
Product Overview : | Recombinant Human AMTN protein(17-209 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 17-209 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LPQLKPALGLPPTKLAPDQGTLPNQQQSNQVFPSLSLIPLTQMLTLGPDLHLLNPAAGMTPGTQTHPLTLGGLNVQQQLHPHVLPIFVTQLGAQGTILSSEELPQIFTSLIIHSLFPGGILPTSQAGANPDVQDGSLPAGGAGVNPATQGTPAGRLPTPSGTDDDFAVTTPAGIQRSTHAIEEATTESANGIQ |
Gene Name | AMTN amelotin [ Homo sapiens ] |
Official Symbol | AMTN |
Synonyms | UNQ689 |
Gene ID | 401138 |
mRNA Refseq | NM_212557.2 |
Protein Refseq | NP_997722.1 |
MIM | 610912 |
UniProt ID | Q6UX39 |
◆ Recombinant Proteins | ||
ABHD6-880HF | Recombinant Full Length Human ABHD6 Protein, GST-tagged | +Inquiry |
ABHD6-79R | Recombinant Rat ABHD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD6-082H | Recombinant Human ABHD6 Protein, GST-Tagged | +Inquiry |
ABHD6-14H | Recombinant Human ABHD6 Protein, His-tagged | +Inquiry |
ABHD6-424R | Recombinant Rat ABHD6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD6-9131HCL | Recombinant Human ABHD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABHD6 Products
Required fields are marked with *
My Review for All ABHD6 Products
Required fields are marked with *
0
Inquiry Basket