Recombinant Human AAPLN protein, GST-tagged

Cat.No. : AAPLN-505H
Product Overview : Human AAPLN full-length ORF (AAH21104.1, 1 a.a. ~ 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a peptide that functions as an endogenous ligand for the G-protein coupled apelin receptor. The encoded preproprotein is proteolytically processed into biologically active C-terminal peptide fragments. These peptide fragments activate different tissue specific signaling pathways that regulate diverse biological functions including fluid homeostasis, cardiovascular function and insulin secretion. This protein also functions as a coreceptor for the human immunodeficiency virus 1. [provided by RefSeq, Feb 2016]
Molecular Mass : 39.16 kDa
AA Sequence : MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APLN apelin [ Homo sapiens ]
Official Symbol APLN
Synonyms APLN; apelin; APEL; XNPEP2; AGTRL1 ligand; APJ endogenous ligand; apelin
Gene ID 8862
mRNA Refseq NM_017413
Protein Refseq NP_059109
MIM 300297
UniProt ID Q9ULZ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APLN Products

Required fields are marked with *

My Review for All APLN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon