Specification
Gene Information
Related Products
Download

Description :	This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections.
Source :	E.coli
Species :	Horse
Form :	Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, with 5 % trehalose.
Bio-activity :	Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 10.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
Molecular Mass :	Approximately 16.7 kDa, a single non-glycosylated polypeptide chain containing 143 amino acids.
Protein length :	143
AA Sequence :	QAAFFKEIENLKEYFNASNPDVGDGGPLFLDILKNWKEDSDKKIIQSQIVSFYFKLFENLKDNQVIQKSMDTIKEDLFVKFFNSSTSKLEDFQKLIQIPVNDLKVQRKAISELIKVMNDLSPKANLRKRKRSQNPFRGRRALQ
Endotoxin :	Less than 0.1 EU/µg of rEqIFN-γ as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag :	Non

Gene Name	IFNG
Official Symbol	IFNG
Synonyms	IFNG; interferon, gamma; interferon gamma; IFN-gamma;
Gene ID	100034181
mRNA Refseq	NM_001081949
Protein Refseq	NP_001075418
UniProt ID	P42160