Recombinant Heloderma Exendin-4 protein

• Cat.No.: Exendin-4-01
• Product Overview: Recombinant Heloderma Exendin-4 protein was expressed in Escherichia coli.

Specification

• Species: Heloderma
• Source: E.coli
• Tag: Non
• ProteinLength: 39
• Description: Exendin-4 is a novel 39-amino acid peptide isolated from the venom of the Gila monster Heloderma suspectum. It shares 53% sequence homology with GLP-17-36amide and interacts with the same membrane receptor. Exendin-4 enhances glucose-dependent insulin secretion, suppresses inappropriately elevated glucagon secretion, and slows gastric emptying in vivo. It also promotes ß-cell proliferation and neogenesis in vitro and in animal models.
• Form: Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
• Bio-activity: 1. Regulates Glucose levels rapidly;2. Reduces Insulin resistance;3. Reduces Glucagon;4. Reduces HbA1c;5. Stimulates beta cell growth which stimulates insulin production.
• Molecular Mass: Approximately 4.2 kDa, a single non-glycosylated polypeptide chain containing 39 amino acids.
• AA Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
• Endotoxin: Less than 10 EU/mg of rExendin-4 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• UniProt ID: P26349