Recombinant Full Length Nitrobacter Hamburgensis Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL5691NF |
Product Overview : | Recombinant Full Length Nitrobacter hamburgensis Membrane protein insertase YidC(yidC) Protein (Q1QH68) (1-609aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nitrobacter hamburgensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-609) |
Form : | Lyophilized powder |
AA Sequence : | MMSENRNTIIAIVLSGLILIAWQYFYNIPQMEKDRAAQQAQSQTAKSPTEPTPNSPKPDH PAAESVVARGVAIATTPRVKIDTPRLSGSISLKGARIDDLLLTKFRETVDPASPAIELFS PSGTTTPYYAEFGWVAATGSTARVPDQNTVWQQEGSGALTQSTPVTLKYDNGEGLTFRRT IAVDDHYLFTIKDEVTNAGGAPVTLYPFALISRHGTPAVSGYYILHEGLIGYLGDQKLQE YSYKKIDEAKSVSFKVTNGWLGITDKYWAAALLPDTSAQLQARFSSNESGSVKTYQADYL EDAQTIPVGGTGSVNTRLFAGAKEAGVVGINFPFVELGGYNKQLGLNHFDLLIDWGWFYF ITKPMFLALDFFFHVFGNFGIAILFVTVLIKAIFFPLANRSYASMAKMKAVQPQIAALKE RFPDDKMKLQQEMMEIYKKEKINPISGCLPMVLQIPVFFSLYKVLFVTIEMRHAPFFAWI KDLSAPDPTHIFNLFGLLPYDPSAVPLLGPYLAIGAWPIIMGITMWFQMKLNPTPPDPTQ KLIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELLNNVKSVFRR KSSDKPAKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Nham_3703; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q1QH68 |
◆ Recombinant Proteins | ||
DNAJC3-2387H | Recombinant Human DNAJC3 Protein, MYC/DDK-tagged | +Inquiry |
GRB2B-12273Z | Recombinant Zebrafish GRB2B | +Inquiry |
TUFM-6366R | Recombinant Rat TUFM Protein | +Inquiry |
FBXL18-3329Z | Recombinant Zebrafish FBXL18 | +Inquiry |
RFL25565MF | Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1147(Mj1147) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
Mucin-313 | Native Porcine Mucin Type III protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAD-8529HCL | Recombinant Human BAD 293 Cell Lysate | +Inquiry |
RGS19-2379HCL | Recombinant Human RGS19 293 Cell Lysate | +Inquiry |
ISM2-5146HCL | Recombinant Human ISM2 293 Cell Lysate | +Inquiry |
CDK2-708HCL | Recombinant Human CDK2 cell lysate | +Inquiry |
ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket