Recombinant HBV Surface Antigen preS2 protein
Cat.No. : | HBV-06 |
Product Overview : | Recombinant HBV Surface Antigen preS2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HBV |
Source : | E.coli |
Tag : | Non |
Protein Length : | 55 |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
Molecular Mass : | Approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. |
AA Sequence : | MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN |
Endotoxin : | Less than 1 EU/μg of rHBsAg-preS2 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Applications : | 1. Immunochromatography (capture and conjugate);2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2;3. ELISA. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at |
◆ Recombinant Proteins | ||
HBV-05 | Recombinant HBV Surface Antigen preS1 protein | +Inquiry |
HBV-06 | Recombinant HBV Surface Antigen preS2 protein | +Inquiry |
HBcAg-15H | Recombinant Human HBV Core Protein | +Inquiry |
HBV-04 | Recombinant Hepatitis B Surface Antigen Adw Subtype | +Inquiry |
HBV-03 | Recombinant HBV Surface Antigen (adr) protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HBV Products
Required fields are marked with *
My Review for All HBV Products
Required fields are marked with *
0
Inquiry Basket