Recombinant HBV Surface Antigen preS1 protein

• Cat.No.: HBV-05
• Product Overview: Recombinant HBV Surface Antigen preS1 protein was expressed in Escherichia coli.

Specification

• Species: HBV
• Source: E.coli
• Tag: Non
• Protein Length: 119
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
• Molecular Mass: Approximately 12.6 kDa, a single non-glycosylated polypeptide chain containing 119 amino acids.
• AA Sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
• Endotoxin: Less than 1 EU/μg of rHBsAg-preS1 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Applications: 1. Immunochromatography (capture and conjugate);2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS1;3. ELISA.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.