Recombinant Full Length Zygnema Circumcarinatum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL28490ZF |
Product Overview : | Recombinant Full Length Zygnema circumcarinatum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q32RQ6) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zygnema circumcarinatum (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGVTQSWGGWSITGETVTNAGLWSYEGVAAVHIVLSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGVWVSDPYGLTGRVQP VAPAWGAEGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNVETVLSS SIAAVFFAAFVVAGTMWYGCAATPVELFGPTRYQWDQGYFQQEIDRRIRNSVAENVSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKEGNELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSIEQVGVSVEFYGGELNGVSFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHACFALLFFFGHLWHGSRTLFRDVFA GIDPDLDSQVEFGLFQKLGDPTTRKQTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q32RQ6 |
◆ Recombinant Proteins | ||
KIAA1024-2216R | Recombinant Rhesus Macaque KIAA1024 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACAA2-434R | Recombinant Rat ACAA2 Protein | +Inquiry |
RFL18329DF | Recombinant Full Length Deinococcus Radiodurans Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
SMAD3-2256H | Recombinant Human SMAD3 protein, His-tagged | +Inquiry |
SAOUHSC-01653-0029S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01653 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
COL3A1-17B | Native Bovine COL3A1 Protein | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
ALB-38R | Native Rhesus monkey Albumin (ALB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAI1-6896HCL | Recombinant Human DNAI1 293 Cell Lysate | +Inquiry |
VAC14-1901HCL | Recombinant Human VAC14 cell lysate | +Inquiry |
GLA-1521MCL | Recombinant Mouse GLA cell lysate | +Inquiry |
SLU7-1679HCL | Recombinant Human SLU7 293 Cell Lysate | +Inquiry |
VAMP3-437HCL | Recombinant Human VAMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket