Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL1477PF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P51322) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porphyra purpurea (Red seaweed) (Ulva purpurea) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGM FVMPFMARLGVTDSWGGWSITGESVSNPGLWSLEGVALTHIVLSGMLFLAAIWHWVYWDL ELFRDPRTGEPALDLPKIFGIHLLLSSLLCFGFGAFHVTGLFGPGMWVSDGYGVTGKVLP VAPAWGPEGFNPFNPGGVASHHIAAGTVGILAGVFHLTVRPPQRLYRALRMGNIETVLSS SISAVFFSAFITCGTMWYGSATTPIELFGPTRYQWDSGYFQQEIEKRVENAIADGAAPSE AWSRIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGVAEAWLGHPVFQDKEGRELSVRRMP AFFETFPVILVDKDGIIRADIPFRRAESKYSIEQVGVTASFYGGKLNGQVFNDAPSVKKY ARKAQLGEVFEFDRTTLESDGVFRSSPRGWFTFGHANFALIFFFGHLWHGSRTIFRDVFA GIGAEVTEQVEFGAFQKLGDRSSKKQGAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P51322 |
◆ Recombinant Proteins | ||
NUCB1-3770R | Recombinant Rat NUCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNPE-0712S | Recombinant Staphylococcus aureus (strain: TPS162) TNPE protein, His-tagged | +Inquiry |
LRFN5-5154M | Recombinant Mouse LRFN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
COG3-1624H | Recombinant Human COG3 Protein, GST-tagged | +Inquiry |
ENG-5969H | Recombinant Human ENG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Alb-113R | Native Rat Serum Albumin | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
HPX-206H | Native Human Native Human HPX | +Inquiry |
ATF-181R | Native Rat Apotransferrin | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAGE2-467HCL | Recombinant Human PAGE2 lysate | +Inquiry |
STYX-1370HCL | Recombinant Human STYX 293 Cell Lysate | +Inquiry |
ACOT6-9088HCL | Recombinant Human ACOT6 293 Cell Lysate | +Inquiry |
LZTFL1-4575HCL | Recombinant Human LZTFL1 293 Cell Lysate | +Inquiry |
GPR83-5776HCL | Recombinant Human GPR83 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket