Recombinant Full Length Oenothera Parviflora Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL36599OF |
Product Overview : | Recombinant Full Length Oenothera parviflora Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (B0Z5F4) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oenothera parviflora (Small-flowered evening primrose) (Oenothera cruciata) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGSHILFSGLCFLAAIWHWVYWDL AIFSDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGEVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDSGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDTQVEFGAFQKLGDPTTRRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | B0Z5F4 |
◆ Recombinant Proteins | ||
Xpnpep2-7019M | Recombinant Mouse Xpnpep2 Protein, Myc/DDK-tagged | +Inquiry |
CALU-2661M | Recombinant Mouse CALU Protein | +Inquiry |
PPFIA1-8113H | Recombinant Human PPFIA1 protein, His & T7-tagged | +Inquiry |
GPC5-2004H | Recombinant Human GPC5 Protein, His-tagged | +Inquiry |
OO66-RS33555-1499S | Recombinant Streptomyces virginiae OO66_RS33555 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUEDC2-7186HCL | Recombinant Human CUEDC2 293 Cell Lysate | +Inquiry |
ASPH-8643HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
NUMB-3635HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
ANKRD33-24HCL | Recombinant Human ANKRD33 lysate | +Inquiry |
SUSD4-787HCL | Recombinant Human SUSD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket