Recombinant Full Length Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL10979SF |
Product Overview : | Recombinant Full Length Zinc transport protein ZntB(zntB) Protein (Q83KS5) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRFGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; SF1826.1; S1446; Zinc transport protein ZntB |
UniProt ID | Q83KS5 |
◆ Recombinant Proteins | ||
CRLF1-311H | Recombinant Human CRLF1, GST-tagged | +Inquiry |
CSNK1G1-1194H | Recombinant Human CSNK1G1 Protein (D2-K422), Tag Free | +Inquiry |
MCAM-1328H | Recombinant Human MCAM protein, His-tagged, Biotinylated | +Inquiry |
MRAY-0368B | Recombinant Bacillus subtilis MRAY protein, His-tagged | +Inquiry |
VDAC2-6306C | Recombinant Chicken VDAC2 | +Inquiry |
◆ Native Proteins | ||
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2660HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
TRPA1-1841HCL | Recombinant Human TRPA1 cell lysate | +Inquiry |
LGALS9-4761HCL | Recombinant Human LGALS9 293 Cell Lysate | +Inquiry |
Eye-488C | Chicken Eye Lysate, Total Protein | +Inquiry |
SIPA1L1-1835HCL | Recombinant Human SIPA1L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket