Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL29429EF |
Product Overview : | Recombinant Full Length Escherichia coli Zinc transport protein ZntB(zntB) Protein (B1LG86) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; EcSMS35_1780; Zinc transport protein ZntB |
UniProt ID | B1LG86 |
◆ Recombinant Proteins | ||
TNFRSF8-5858R | Recombinant Rat TNFRSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGM2-2712H | Recombinant Human TGM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HA-402V | Recombinant H3N2 HA protein(Met1-Arg345), His-tagged | +Inquiry |
Necab3-4353M | Recombinant Mouse Necab3 Protein, Myc/DDK-tagged | +Inquiry |
PNAT10-6892C | Recombinant Chicken PNAT10 | +Inquiry |
◆ Native Proteins | ||
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUP35-1231HCL | Recombinant Human NUP35 cell lysate | +Inquiry |
MRPL24-4185HCL | Recombinant Human MRPL24 293 Cell Lysate | +Inquiry |
FHL2-6223HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
LZTS1-4574HCL | Recombinant Human LZTS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket