Recombinant Full Length Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL21564SF |
Product Overview : | Recombinant Full Length Zinc transport protein ZntB(zntB) Protein (Q8Z784) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFFTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; STY1409; t1560; Zinc transport protein ZntB |
UniProt ID | Q8Z784 |
◆ Native Proteins | ||
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
TF-324H | Native Human Transferrin, Texas Red Label | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABBR2-6072HCL | Recombinant Human GABBR2 293 Cell Lysate | +Inquiry |
SV2A-1329HCL | Recombinant Human SV2A 293 Cell Lysate | +Inquiry |
RERGL-638HCL | Recombinant Human RERGL cell lysate | +Inquiry |
MTUS1-426HCL | Recombinant Human MTUS1 lysate | +Inquiry |
P3H2-377HCL | Recombinant Human P3H2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket