Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL409EF |
Product Overview : | Recombinant Full Length Escherichia coli Zinc transport protein ZntB(zntB) Protein (Q1RC23) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; UTI89_C1613; Zinc transport protein ZntB |
UniProt ID | Q1RC23 |
◆ Recombinant Proteins | ||
NANOG-159H | Recombinant Human NANOG Protein, 13-residue TAT-tagged | +Inquiry |
Ckb-895M | Recombinant Mouse Ckb Protein, MYC/DDK-tagged | +Inquiry |
GPC5-2004H | Recombinant Human GPC5 Protein, His-tagged | +Inquiry |
TDP2B-4893Z | Recombinant Zebrafish TDP2B | +Inquiry |
CTRL-3372H | Recombinant Human CTRL Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFC2-2412HCL | Recombinant Human RFC2 293 Cell Lysate | +Inquiry |
CELA3A-7592HCL | Recombinant Human CELA3A 293 Cell Lysate | +Inquiry |
FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
GABPB1-6068HCL | Recombinant Human GABPB1 293 Cell Lysate | +Inquiry |
VCY1B-731HCL | Recombinant Human VCY1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket