Recombinant Full Length Zea Mays Cell Number Regulator 2(Cnr2) Protein, His-Tagged
Cat.No. : | RFL25273ZF |
Product Overview : | Recombinant Full Length Zea mays Cell number regulator 2(CNR2) Protein (B6TYV8) (1-181aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-181) |
Form : | Lyophilized powder |
AA Sequence : | MYPKAADEGAQPLATGIPFSGGGGYYQAGGAMAAAFAVQAQAPVAAWSTGLCNCFDDCHN CCVTCVCPCITFGQTAEIIDRGSTSCGTSGALYALVMLLTGCQCVYSCFYRAKMRAQYGL QVSPCSDCCVHCCCQCCALCQEYRELKKRGFDMSIGWHANMERQGRAAAAVPPHMHPGMT R |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNR2 |
Synonyms | CNR2; Cell number regulator 2; ZmCNR02 |
UniProt ID | B6TYV8 |
◆ Recombinant Proteins | ||
CNR2-26236TH | Recombinant Human CNR2 | +Inquiry |
CNR2-14HFL | Recombinant Full Length Human CNR2 Proteoliposome | +Inquiry |
CNR2-12213Z | Recombinant Zebrafish CNR2 | +Inquiry |
CNR2-738H | Recombinant Human CNR2 protein(Met1-Cys360) | +Inquiry |
Cnr2-29R | Recombinant Rat Cnr2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNR2 Products
Required fields are marked with *
My Review for All CNR2 Products
Required fields are marked with *
0
Inquiry Basket