Recombinant Full Length Human CNR2 Proteoliposome

• Cat.No.: CNR2-14HFL
• Product Overview: Human CNR2 full-length ORF (NP_001832.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Description: The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors.
• Form: Liquid
• Molecular Mass: 39.7 kDa
• AA Sequence: MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
• Applications: Antibody Production
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Preparation: in vitro wheat germ expression system with proprietary liposome technology

Gene Information

• Gene Name: CNR2 cannabinoid receptor 2 [ Homo sapiens (human) ]
• Official Symbol: CNR2
• Synonyms: CB2; CX5; CB-2
• Gene ID: 1269
• mRNA Refseq: NM_001841.3
• Protein Refseq: NP_001832.1
• MIM: 605051
• UniProt ID: P34972