Recombinant Full Length Yersinia Pestis Bv. Antiqua Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL4163YF |
Product Overview : | Recombinant Full Length Yersinia pestis bv. Antiqua Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q1CGD7) (1-649aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis bv. Antiqua |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-649) |
Form : | Lyophilized powder |
AA Sequence : | MAALLELEGIRRSYQSGEEIVDVLQDVSLTINAGELVAIIGASGSGKSTLMNILGCLDKP SAGIYRVAGQNVDELDDDALAALRREHFGFIFQRYHLLPHLSAAHNVEVPAVYAGLGKHE RRERANMLLTRLGLGDRVSYQPNQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSS VEVMAILKQLQQQGHTVIIVTHDPTVAAQAERVIEIKDGRIMADSGSKNEPVVAAAELMS LTPAAPSWQQLVGRFREALLMAWRAMSANKMRTALTMLGIIIGIASVVSILVVGDAAKQL VLADIRAIGTNTIDIYPGKDFGDDDPSTRQALVHDDMAALKAQSYVSAVSPSIGGSMRLR FGNIDVAASVLGVSDEYFRVFGMAMEQGAPITREQVERQAQTVVIDLNTQRRLFPHMKDV VGQVILVGNMPATVVGVVAEKKSMFGSNKALRVWVPYSTMANRLMGRSYFDSITIRIKEG YSSKEAEQQLVRLLTLRHGKKDIFTYNMDSLLQTAEKTTQTMQLFLTLVAVISLVVGGIG VMNIMLVSVTERTREIGIRMAVGARSSDVMQQFLIEAVLVCLIGGALGISLSFAIGLIVE MFLPNWRIAFPPMALFSAFLCSTVIGVVFGYLPARSAARLNPIDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; YPN_2615; YP516_2949; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q1CGD7 |
◆ Recombinant Proteins | ||
FLT3LG-8901H | Active Recombinant Human FLT3LG | +Inquiry |
BAX-6976H | Recombinant Human BAX, His-tagged | +Inquiry |
RFL33547BF | Recombinant Full Length Brassica Napus Oleosin-B2(Olnb2) Protein, His-Tagged | +Inquiry |
FAIM2-12646H | Recombinant Human FAIM2, GST-tagged | +Inquiry |
LYZL6-134H | Recombinant Human LYZL6, His-tagged | +Inquiry |
◆ Native Proteins | ||
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
F2-5401B | Native Bovine Coagulation Factor II (thrombin) | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE2-6863HCL | Recombinant Human DNASE2 293 Cell Lysate | +Inquiry |
GSTM4-5711HCL | Recombinant Human GSTM4 293 Cell Lysate | +Inquiry |
WTAP-277HCL | Recombinant Human WTAP 293 Cell Lysate | +Inquiry |
MSL1-423HCL | Recombinant Human MSL1 lysate | +Inquiry |
KLHDC3-4921HCL | Recombinant Human KLHDC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket