Recombinant Human LYZL6, His-tagged

Cat.No. : LYZL6-134H
Product Overview : Recombinant Human Lysozyme-Like Protein 6/LYZL6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser20-Arg148) of Human LYZL6 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-148 a.a.
Description : Lysozyme-Like Protein 6 (LYZL6) is a member of the C-type lysozyme/α-lactalbumin family. Proteins of this family are bacteriolytic factors that play a role in host defense, whereas α-lactalbumins mediate lactose biosynthesis. LYZL6 is a secreted protein and expressed in the testis and epididymis. LYZL6 contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Lysozyme-like protein 6 can hydrolyze the (1->4)-β-linkages between N-Acetylmuramic Acid and N-Acetyl-D-Glucosamine residues in a peptidoglycan and between N-Acetyl-D-Glucosamine residues in Chitodextrins.
AA Sequence : SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS KINENADGSFDYGLFQINSHYWC NDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA RGMNNWVEWRLHCSGRPLFYWLTGCRL RVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LYZL6 Products

Required fields are marked with *

My Review for All LYZL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon