Recombinant Human BAX, His-tagged

• Cat.No.: BAX-6976H
• Product Overview: Recombinant Human Apoptosis Regulator BAX/BAX is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln171) of Human BAX fused with a 6His tag at both the N-terminus and C-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met1-Gln171
• Form: Lyophilized from sterile 20mM PB,150mM NaCl, 2mM EDTA, 5% Threhalose, pH7.4.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH
• Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method.
• Purity: >95% as determined by SDS-PAGE.
• Stability: Samples are stable for up to twelve months from date of receipt at -70ºC.
• Storage: Store it under sterile conditions at -20ºC~-70ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.
• Publications:
  Does VDAC2 Have A BH3 Domain? (2023)
  Is VDAC1 a Novel BCL2 Family Member that Binds BAX? (2023)
  Development of novel cytoprotective small compounds inhibiting mitochondria-dependent cell death (2023)

Gene Information

• Gene Name: BAX BCL2-associated X protein [ Homo sapiens ]
• Official Symbol: BAX
• Synonyms: BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega
• Gene ID: 581
• mRNA Refseq: NM_004324
• Protein Refseq: NP_004315
• MIM: 600040
• UniProt ID: Q07812