Recombinant Human BAX, His-tagged
Cat.No. : | BAX-6976H |
Product Overview : | Recombinant Human Apoptosis Regulator BAX/BAX is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln171) of Human BAX fused with a 6His tag at both the N-terminus and C-terminus. |
Availability | March 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met1-Gln171 |
Form : | Lyophilized from sterile 20mM PB,150mM NaCl, 2mM EDTA, 5% Threhalose, pH7.4. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method. |
Purity : | >95% as determined by SDS-PAGE. |
Stability : | Samples are stable for up to twelve months from date of receipt at -70ºC. |
Storage : | Store it under sterile conditions at -20ºC~-70ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
Publications : |
Does VDAC2 Have A BH3 Domain? (2023)
Is VDAC1 a Novel BCL2 Family Member that Binds BAX? (2023)
Development of novel cytoprotective small compounds inhibiting mitochondria-dependent cell death (2023)
|
Gene Name | BAX BCL2-associated X protein [ Homo sapiens ] |
Official Symbol | BAX |
Synonyms | BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega; |
Gene ID | 581 |
mRNA Refseq | NM_004324 |
Protein Refseq | NP_004315 |
MIM | 600040 |
UniProt ID | Q07812 |
◆ Recombinant Proteins | ||
BAX-26650TH | Recombinant Human BAX protein, GST-tagged | +Inquiry |
BAX-094H | Recombinant Human BAX Protein, GST-tagged | +Inquiry |
BAX-300P | Recombinant Pig BAX Protein, His-tagged | +Inquiry |
BAX-3974H | Recombinant Human BAX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BAX-0221H | Recombinant Human BAX Protein (Met1-Gln171), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAX-8506HCL | Recombinant Human BAX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAX Products
Required fields are marked with *
My Review for All BAX Products
Required fields are marked with *
0
Inquiry Basket