Recombinant Full Length Yersinia Pestis Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL4078YF |
Product Overview : | Recombinant Full Length Yersinia pestis Bifunctional protein aas(aas) Protein (A4TLD3) (1-718aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-718) |
Form : | Lyophilized powder |
AA Sequence : | MAYRLLRALFRGLFRVTIDGVTDQFKHEKLIITPNHVSFLDGALLALFLPIKPVFAVYTS ITDTWYMRWLKPYVDFVALDPTNPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLDGPEFTHFGRLQGVLKTRWFPKISIHVLPATTIPMPQAPRSRE RRVLAGEHLHTIMMAARMATVPRETLFEALLSAQTRYGRFKPCIEDVSFKEDSYQTLLKK TLGVSRILQRFTVPGEHVGMLLPNATITAAAIFGASLRGRIPALLNYTSGAKGLQSAIIA ASLKTIVTSRQFLEKGKLTHLPEQVNEVNWVYLEDLKDTVTLTDKLWILFHLCFPRRAML PQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR VRYVVAGAEKLAESTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM EARLINVPGIAQGGRLQLRGPNIMRGYLRVENPGVLEQPSAENAQGELDANWYDTGDIVT LDEQGFCAIRGRVKRFAKLAGEMVSLESVEQLAISLSPEGQHAAAAKTDSAKGEALVLFT TDSEITRERLIKVARENGVPELAVPRDIRVVKALPLLGSGKPDFVTLGKMAQDPEMSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; YPDSF_1710; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Lo |
UniProt ID | A4TLD3 |
◆ Recombinant Proteins | ||
ZSWIM3-3762H | Recombinant Human ZSWIM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENPEP-1476R | Recombinant Rhesus monkey ENPEP Protein, His-tagged | +Inquiry |
APC-12H | Recombinant Human APC protein, GST-tagged | +Inquiry |
TGFB3-2004P | Recombinant Pig TGFB3 protein, His & T7-tagged | +Inquiry |
CCT8-132C | Recombinant Cynomolgus Monkey CCT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAHD1-8524HCL | Recombinant Human BAHD1 293 Cell Lysate | +Inquiry |
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
USP5-561HCL | Recombinant Human USP5 cell lysate | +Inquiry |
ADAM9-1750MCL | Recombinant Mouse ADAM9 cell lysate | +Inquiry |
MAVS-1909HCL | Recombinant Human MAVS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket