Recombinant Full Length Shigella Flexneri Serotype 5B Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL4609SF |
Product Overview : | Recombinant Full Length Shigella flexneri serotype 5b Bifunctional protein aas(aas) Protein (Q0T128) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri serotype 5b |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPDLVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; SFV_2914; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long |
UniProt ID | Q0T128 |
◆ Recombinant Proteins | ||
Ankrd37-1635M | Recombinant Mouse Ankrd37 Protein, Myc/DDK-tagged | +Inquiry |
PRTN3-6020H | Recombinant Human PRTN3 Protein (Ile28-Arg249), N-GST tagged | +Inquiry |
LEP-07C | Recombinant Chicken Leptin | +Inquiry |
CCR9-16H | Recombinant Human Full Length CCR9 protein, His-tagged(VLPs) | +Inquiry |
CNN3-416H | Recombinant Human CNN3 Protein (2-329 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
C20orf4-8114HCL | Recombinant Human C20orf4 293 Cell Lysate | +Inquiry |
Uterus-Corpus-554R | Rhesus monkey Uterus-Corpus Lysate | +Inquiry |
MARC1-4246HCL | Recombinant Human MOSC1 293 Cell Lysate | +Inquiry |
SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket