Recombinant Full Length Shigella Sonnei Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL3078SF |
Product Overview : | Recombinant Full Length Shigella sonnei Bifunctional protein aas(aas) Protein (Q3YY21) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella sonnei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; SSON_2996; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Lon |
UniProt ID | Q3YY21 |
◆ Recombinant Proteins | ||
SAOUHSC-01007-3679S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01007 protein, His-tagged | +Inquiry |
Tac2-6269M | Recombinant Mouse Tac2 Protein, Myc/DDK-tagged | +Inquiry |
NF2-22H | Recombinant Human NF2 protein, GST-tagged | +Inquiry |
HOXA5-3711HF | Recombinant Full Length Human HOXA5 Protein, GST-tagged | +Inquiry |
OGT-940H | Active Recombinant Human OGT protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGG-26469TH | Native Human Fibrinogen protein | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
AC-62H | Native Human Activated Protein C | +Inquiry |
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK2-508HCL | Recombinant Human AK2 cell lysate | +Inquiry |
IL24-1922HCL | Recombinant Human IL24 cell lysate | +Inquiry |
LDB1-4792HCL | Recombinant Human LDB1 293 Cell Lysate | +Inquiry |
FGFRL1-2480MCL | Recombinant Mouse FGFRL1 cell lysate | +Inquiry |
SLC6A9-1702HCL | Recombinant Human SLC6A9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket