Recombinant Full Length Salmonella Paratyphi C Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL2612SF |
Product Overview : | Recombinant Full Length Salmonella paratyphi C Bifunctional protein aas(aas) Protein (C0PXJ8) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella paratyphi C |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFGFFRNLFRVLYRVRVTGDVQALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRPVVIFPEGRISVTGSLMKIYDG AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPPTQIPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCIEDINFTPDTYRKLLTK TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV KQQPEDEAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETERGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSAEKMHATAIKSDASKGEALVLFT TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; SPC_3068; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long |
UniProt ID | C0PXJ8 |
◆ Recombinant Proteins | ||
C9orf78-0213H | Recombinant Human C9orf78 Protein, GST-Tagged | +Inquiry |
ANGEL2-1498HF | Recombinant Full Length Human ANGEL2 Protein, GST-tagged | +Inquiry |
TAS2R119-5947R | Recombinant Rat TAS2R119 Protein | +Inquiry |
NEK9-0834H | Recombinant Human NEK9 Protein (S2-L979), Tag Free | +Inquiry |
KL-29904TH | Recombinant Human KL | +Inquiry |
◆ Native Proteins | ||
Lectin-1772E | Active Native Erythrina Cristagalli Lectin Protein, Agarose bound | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
ALB-524H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Temporal Lobe-507H | Human Temporal Lobe Membrane Lysate | +Inquiry |
NPAS2-1208HCL | Recombinant Human NPAS2 cell lysate | +Inquiry |
HDC-5600HCL | Recombinant Human HDC 293 Cell Lysate | +Inquiry |
NOP58-3762HCL | Recombinant Human NOP58 293 Cell Lysate | +Inquiry |
LCN10-4801HCL | Recombinant Human LCN10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket