Recombinant Full Length Yarrowia Lipolytica Palmitoyltransferase Erf2(Erf2) Protein, His-Tagged
Cat.No. : | RFL16459YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Palmitoyltransferase ERF2(ERF2) Protein (Q6C890) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MDFYTPPTTAGPPTRGSPESVPTTAASTFPLRKRTRAHLRARDKSDGPAPSSRGTSDRLW SWVFLKQPLSLPEHNYQAHLGNNVFLIGGRFLSARQKPLNIAVLCVILILGGLYYGFVAP WTWNHISPAIPAVFTYIFLLCVASFLRASFSDPGILPRNIHLTDRIADGSIPNEYSVEPG IDAFDPRKNTTSLSCFKQPESSENLVYLKYCSTCKIWRPPRASHCSDCDNCVDFHDHHCI WLNNCVGRKNYRYFVAFVMTGGLCGLYIVGNSIAHVICYKRHMHMTIAESLRHRPMPLVM IFLGFLGAGYPLALVGFHLWIASRGESTHEFVSMNPVTKHVVDGHVGVTLSKCKVMGSHD GFKRFSDAVLAVVCARLCAHVSPHSNPVTKQTTPQGVQKSTFRHWKRF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERF2 |
Synonyms | ERF2; YALI0D21670g; Palmitoyltransferase ERF2; DHHC cysteine-rich domain-containing protein ERF2; Ras protein acyltransferase |
UniProt ID | Q6C890 |
◆ Recombinant Proteins | ||
LTF-6210HF | Recombinant Full Length Human LTF Protein, GST-tagged | +Inquiry |
COX20-6378HFL | Recombinant Full Length Human COX20 protein, Flag-tagged | +Inquiry |
PRKAR1A-4333R | Recombinant Rat PRKAR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
AYP1020-RS00325-5190S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS00325 protein, His-tagged | +Inquiry |
CHMP2B-27996TH | Recombinant Human CHMP2B | +Inquiry |
◆ Native Proteins | ||
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
VTN-384B | Native Bovine Vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFRB-1046CCL | Recombinant Cynomolgus PDGFRB cell lysate | +Inquiry |
Embryonic Fibroblast-070MCL | Mouse Embryonic Fibroblast Whole Cell Lysate | +Inquiry |
SPZ1-1483HCL | Recombinant Human SPZ1 293 Cell Lysate | +Inquiry |
DCTN5-7038HCL | Recombinant Human DCTN5 293 Cell Lysate | +Inquiry |
TSKS-1845HCL | Recombinant Human TSKS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ERF2 Products
Required fields are marked with *
My Review for All ERF2 Products
Required fields are marked with *
0
Inquiry Basket