Recombinant Full Length Candida Albicans Palmitoyltransferase Erf2(Erf2) Protein, His-Tagged
Cat.No. : | RFL31903CF |
Product Overview : | Recombinant Full Length Candida albicans Palmitoyltransferase ERF2(ERF2) Protein (Q59QL0) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MDPNLISHYNNTNTRRFKNYQIENQGQSNFIYFLGGRLHTIKTKYPINLITLSLIIIPGI LYIIFELSWQWRNFSPIIVIIFLYIWIISIFHFFKLSTGDAGKLPKNIHLPKKLITITTT TTTTNDNEIDHRNNYKVRGSPPDEYFNTVTLPYWKTNNDNNDNTKISKLANAYHSHGVQV KYCGTCHIWRPSRTSHCNTCQQCILNHDHHCIFLNNCIGQRNYKFFLWFLLYIVIACLYL LIISILQLCHYKFASHKESEIITTFNQSIKTHPISLLLLIYSCLAICYPGLLLAFHIFLT SQNITTREYLNFVYKKPSKSTDGGDGTRGFVNVYNTHSIWENLYINWLGKSNGVSLTFPR DYYHQGDIRFANIEPLGTFTNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERF2 |
Synonyms | ERF2; CAALFM_C103920CA; CaO19.11946; CaO19.4466; Palmitoyltransferase ERF2; DHHC cysteine-rich domain-containing protein ERF2; Ras protein acyltransferase |
UniProt ID | Q59QL0 |
◆ Recombinant Proteins | ||
SNX30-8555M | Recombinant Mouse SNX30 Protein, His (Fc)-Avi-tagged | +Inquiry |
S-5505S | Recombinant SARS-CoV-2 S Trimer Protein (KV-PP) Protein (Gln14-Gln1208), C-His tagged | +Inquiry |
PCYT1B-3154R | Recombinant Rhesus Macaque PCYT1B Protein, His (Fc)-Avi-tagged | +Inquiry |
PI3-1204HFL | Recombinant Full Length Human PI3 Protein, C-Flag-tagged | +Inquiry |
CYP20A1-2825H | Recombinant Human CYP20A1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C2-98H | Active Native Human C2 Protein | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
Alb-503R | Native Rat Alb Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC38A3-1632HCL | Recombinant Human SLC38A3 cell lysate | +Inquiry |
CACNB4-7902HCL | Recombinant Human CACNB4 293 Cell Lysate | +Inquiry |
CUL3-7183HCL | Recombinant Human CUL3 293 Cell Lysate | +Inquiry |
XYLT2-251HCL | Recombinant Human XYLT2 293 Cell Lysate | +Inquiry |
ASL-001HCL | Recombinant Human ASL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ERF2 Products
Required fields are marked with *
My Review for All ERF2 Products
Required fields are marked with *
0
Inquiry Basket