Recombinant Full Length Neosartorya Fumigata Palmitoyltransferase Erf2(Erf2) Protein, His-Tagged
Cat.No. : | RFL6952NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Palmitoyltransferase erf2(erf2) Protein (Q4WWN2) (1-607aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-607) |
Form : | Lyophilized powder |
AA Sequence : | MSSAPETSDADHVSTAQPALGIPRPPSVGGISSRMTDVASEDGEQSQANTGISSRPPQSQ RSLSRRGPPPARSSITAHSQMTSRPGSSASRLSRSHIPSLTAQGFFRPMSSQRLQAHRGR PVTKETATPSEDWNDQLDQNRQSIISNGTFPQSSAPQEEAPPSRGTEFTDPIIPDRNTSN ASPFGNTTSRSVGESAKLLHDRDRVYKITPQHLDLGANHNIEKSDPSQRSPLSFLSLQNG NTAPEPRDNRAHERLSSADSSPGSIQKQHHAPTSANLGKNYEYFTGNTLFFGGGRFQNSR DKPINIATGIFVVLPSALFFAYSAPWLWHHISPAVPILFAYLFYICFSSFIHASVVDPGI IPRNLHPMPPPEPSGDPLLIGPPTNDWVMVKLATSDVAAMDVPVKYCKTCNIWRPPRCYH CRVCDNCVETLDHHCVWLNNCVGRRNYRYFFAFVSSATLLALFLLGASLAHVLVYRAREG VSFGSAIDKWRVPWAMVIYGALAAPYPASLWAYHLFLIGRGETTREYLNSHKFAKADRHR PFTQGNIFRNWISVLARPRPPTYLQFKRPYQEGDQRLSAMKRKDRPRDVEAQADIEMQHV PPTPRQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | erf2 |
Synonyms | erf2; AFUA_3G06470; Palmitoyltransferase erf2; DHHC cysteine-rich domain-containing protein erf2; Ras protein acyltransferase |
UniProt ID | Q4WWN2 |
◆ Recombinant Proteins | ||
EPB41-4350HF | Recombinant Full Length Human EPB41 Protein, GST-tagged | +Inquiry |
AFM-410H | Recombinant Human AFM Protein, GST-tagged | +Inquiry |
ROR1-0656H | Active Recombinant Human / Cynomolgus / Rhesus macaque ROR1 protein, mFc-tagged | +Inquiry |
FNDC3A-2906H | Recombinant Human FNDC3A protein, His-tagged | +Inquiry |
Mcts1-4000M | Recombinant Mouse Mcts1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
α-Crystallin-01B | Native Bovine α-Crystallin Protein | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
ZNF212-121HCL | Recombinant Human ZNF212 293 Cell Lysate | +Inquiry |
CXCR7-7159HCL | Recombinant Human CXCR7 293 Cell Lysate | +Inquiry |
ASIC1-9101HCL | Recombinant Human ACCN2 293 Cell Lysate | +Inquiry |
SLC25A2-1778HCL | Recombinant Human SLC25A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All erf2 Products
Required fields are marked with *
My Review for All erf2 Products
Required fields are marked with *
0
Inquiry Basket