Recombinant Full Length Xenopus Laevis Transmembrane Protein 214-B(Tmem214-B) Protein, His-Tagged
Cat.No. : | RFL6992XF |
Product Overview : | Recombinant Full Length Xenopus laevis Transmembrane protein 214-B(tmem214-b) Protein (A1L2I9) (1-679aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-679) |
Form : | Lyophilized powder |
AA Sequence : | MASGAPDGKWKVVKKGKKSGERREGERKALTESNVTPGGTAPIKMANTVYEMGFDRIHKK QNKEQVPPNNMSSEQPQKQQQNPGKKKPQSGDSVCKQSKFHTLECALKALDVAELQRDLE KSQNMFPENPSIWVKDLAGYLNYKLQTVKNDVLIQQSHDYPYCLINKELKGIVRSLLAKA PHVLDVMVDHCIFSMLQELDKPTGESLHGYRICIQAVLLDKPKTVTSNLPKYLELLRSHL NRPMKCLTVMWAVGQAGFTDFTEGLKVWLGLMFPVLGVKNLTPYAILYLDRLLLAHSNLT KGFGMIGPKDFFPILDFAFMPNNSLTPSQQENLRNLYPKLKVLALGATPESTLHTYFPSF LSRATPSCPAEMRKELIHSLTDCLNKDSLSFSVWRQLYTKHLSQSSLLLQHLVETWDSNS RAMRKSVRETVHSFKVTNGEFSGKGSSSKDLEACDAACQALLHKMKSGGFPWWRLIVIAF VFLFGSVLYDVRTHNSFQESTSAQILQQSGLLSVSREAWNKVSNYSLQGQSWLERNVPQY YSQAVEVLGPVLEQVWAKTQEGGAYACEKGSVLLSYAKDNLPRLIEWLHSSIPDSVFQFI EYLRELLLHLHQTYLLPAVTYLEAAVQNSWQQYVKSCNGKVTWDCVRGQVGNISHSSWTY LQNTTMTFTNWALTIISRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem214-b |
Synonyms | tmem214-b; Transmembrane protein 214-B |
UniProt ID | A1L2I9 |
◆ Recombinant Proteins | ||
NR2F1-1413HFL | Recombinant Full Length Human NR2F1 Protein, C-Flag-tagged | +Inquiry |
FAM46A-3765H | Recombinant Human FAM46A Protein, GST-tagged | +Inquiry |
Epcam-283M | Recombinant Mouse Epcam protein, His-tagged | +Inquiry |
PNKD-8129Z | Recombinant Zebrafish PNKD | +Inquiry |
GKN1-5643H | Recombinant Human GKN1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
A2M-01H | Native Human A2M Protein | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
CA 72-4-379H | Active Native Human Cancer Antigen 72-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR63-5780HCL | Recombinant Human GPR63 293 Cell Lysate | +Inquiry |
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
GIMAP8-5935HCL | Recombinant Human GIMAP8 293 Cell Lysate | +Inquiry |
LOXL4-4676HCL | Recombinant Human LOXL4 293 Cell Lysate | +Inquiry |
XRCC3-256HCL | Recombinant Human XRCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem214-b Products
Required fields are marked with *
My Review for All tmem214-b Products
Required fields are marked with *
0
Inquiry Basket